PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0485s0008.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 393aa    MW: 41895.4 Da    PI: 5.7981
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0485s0008.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.11.9e-33186243158
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                          ldDgy+WrKYGqK vk+s+fprsYYrCts++C vkk+vers+ed  +v++tYeg+H+h
  Kalax.0485s0008.1.p 186 LDDGYRWRKYGQKAVKNSPFPRSYYRCTSPSCGVKKRVERSSEDSAIVVTTYEGQHTH 243
                          59******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.6E-34171245IPR003657WRKY domain
SuperFamilySSF1182901.2E-28178244IPR003657WRKY domain
PROSITE profilePS5081131.307181246IPR003657WRKY domain
SMARTSM007746.4E-40186245IPR003657WRKY domain
PfamPF031061.8E-26187243IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MDGAEDLTAT IDSLFMMSPS FPDQIPASSF SLSGLFDMPP LAASAAPPSA SYSYDIDKSG  60
EGGFLGFSDL LGFQDYCYGA SLFDLIQTSP PLQAVTTTAP SPASTIPETS EVLNGPMTPN  120
SSSNEAAAAA NEEQSEECQG VNGGNTEQED RDRDKTKNQL RPKKKNQKKE KEPRFAFMTK  180
SEIDHLDDGY RWRKYGQKAV KNSPFPRSYY RCTSPSCGVK KRVERSSEDS AIVVTTYEGQ  240
HTHLSPVMAR GSGITGSLLH HHLDSISSSS CSVQLGISSL APPPSFPTPS PSSFLNNNAT  300
ANMVSSLSSF INNSPSPPSN HASPSLGRNP FFKERRFCPS PPAAAGHHPP PTSQHITTAP  360
AAAAAAAGSS SCLMRDDGLL QDMIMRSDSK EE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-261792461077Probable WRKY transcription factor 4
2lex_A2e-261792461077Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279385.16e-73PREDICTED: probable WRKY transcription factor 48
RefseqXP_009372109.12e-72PREDICTED: probable WRKY transcription factor 48
TrEMBLD7SYJ26e-73D7SYJ2_VITVI; Putative uncharacterized protein
STRINGVIT_05s0077g00730.t012e-72(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.12e-39WRKY DNA-binding protein 23